SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_003986 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_003986
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.46e-29
Family PB1 domain 0.00031
Further Details:      
 
Domain Number 2 Region: 123-237
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-22
Family PDZ domain 0.00000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_003986
Sequence length 355
Sequence
MFIFQLDAEFRRFTINPNKVGTYEDFYAFLERMHHLGDVPFLVGYTDPQGDLLPINNDDN
YLKALTSSKPPLKIVLQKRDEVSEGDIQYGSTIPRRKNKISQYLQASQSPKPLKPFKNIG
LPQDFRRVSAIIDVDIVPETHRRVKLHKHGSDKPLGFYIRDGTSMRVTPHGLEKVPGIFI
SRLVPGGLAESTGLLGVNDEVLEVNGIEVSGKTLDQVTDMMVANSANLIITVKPANQRNT
LSKKKQQHLGVSSSLSQSMASLGSLDELSDEDEVQDHSEKPAETGGDGEEKGKKTEETKS
EKMEMREHHGEGDVEITREKKVPSEKILSQSSEKIKQPPDDSETNAISDNEECTL
Download sequence
Identical sequences W4XKQ8
SPU_003986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]