SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPU_004355 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_004355
Domain Number 1 Region: 91-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 58-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_004355
Sequence length 301
Sequence
MWMRNSGRSDRKTGALPVGYNCTIDQECLTYESCIKDKHSGWTSCRCTQAPVITSVGTGS
CVVGQSLCDGIPDCSDRSDEIACSSMKPNSQCAIWEFECEDKSCIPRYKCCDLFKDCQKG
EDEINCITQLRDVPEQEPKPAPSPSGGSNLLIITCTVLMTVVIVTLLIYFRRVRSSQRRF
YSPVSWTLNQHGEAISMPYHVSQHANFCHHLPPHRCPRINGLVGYPLSSGEQVPGEPPDV
LLATLEMTGGPRRFTTSRDRSKDNEGDENDIPPTYSEVIKSDADTRRRGGDETPPPSYED
L
Download sequence
Identical sequences W4XLS5
SPU_004355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]