SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_004779 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_004779
Domain Number 1 Region: 12-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.54e-25
Family Thioltransferase 0.0048
Further Details:      
 
Domain Number 2 Region: 1020-1295,1348-1496
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000025
Family Hermes transposase-like 0.015
Further Details:      
 
Domain Number 3 Region: 102-140
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000101
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_004779
Sequence length 1553
Sequence
MAPAAPTSRAVVMDHIQSNDVMIFSKTYCPFCKKVKELFDTKKIEYKTLELDIRADGEEL
QKVLLDMSGQKTVPNVFIKGTHIGGSDATETAMKEGKITRLLSPPQYDFDLIVIGGGSGG
LAASKEAATLGKTVAVCDFVKPSPKGTTWEVFCLKLIDGHRRPGRRCPSTGRGALPKKDK
FTAKKAVPFFSNWPTCLFFKLDVPFFRNSSRPSGFFYLRFLSLKCVTREIKRCLCPSSEN
VSRIKHNRPSSLQDDHEARPGEKAESASKHDDNGSTPPLAASSSTTSSQQAQMTKSASKH
DDNGSTLPLAASSSTTSSQQAQMTKSASKHDDNGSTLPLAASSSTTSSQQAQMTKSASKH
DDNGSTLPLAASSSTTSSQQAQMTKSASKHDDDGSTPPVAASSSTTSSQEPQMTKSASKH
DDNGSTLPLAASSSTTSSQQAQMTKSASKHDDDVSTPPLAASSSTTSSQQAQMTKSASKH
DDDGSTPPVAAISSTTSSQEPQMTKSASKHDDDGSTPPVAASSSTTSSQQAQMTKSASQH
DDDGSTPPVAASSSTTSSQQAQMTKSASKHDDDGSTLPLAASSSTTFSQQAQMTKSASKH
DDDVSTPPLAASSSTTSSQQAQMTKSASKHDDDGSTPPVAASSSTTSSQEPQMTKSASKP
DDNGSTLPLAASSSTTFSQQAQMTKSASKHDDDVSTPPLAASSSTTSSQQAQMTKSASKH
DDDGSTPPVAASSSTTSSHQAQMTKSASKHDDDGSTPPVAASSSTTSSQQAQMTKSASQH
DDDGSTPPVAASSSTTSSQQAQMTKSASQHDDDGSTPPVAASSSATSSQQPQMTKSLSHP
HDDCASSRSANATRRTKSSTVDSWGYDWLKYNEHNGYVSKVWCSVCQNARHRGTKVSMHP
GQAQICDNDAYIVGTSNVKKDTSKSHSRSKFHLSAVQATLPLVEKSKLAQQFQTMQDRTK
AKMSKLFDIAYMVAHCEQPFTMYKQFVLLEKKHGVDLGVTYINDAACRTFIHHIAATMRE
DLEKLFGQEPFYFSLLFDGSTDKSISEKEVVSIKLIENGIPKIKVLGIAEPERCDAATVE
QAIRKLCEDHNLNLKNGFVASAADGAAVNFGERSGILTRFQQEDAPWLIKMHCIAHRLEL
ALKDAFKNTYYVLIDELMMQMYYIYRRSAKKWREVKAVASALNKHVVKPSRSQGTRWVDH
RRKALKCLATNYHCIVSQFEEQASGQRKDISPADAAKMKGFLKMLKSSKFVLHMSSYRDM
VEYLAELSLGFQRDDLPVSSVGRNILVAQAGLKRMEEKPGSHLRTVLAAATEAVNEEEAE
ESPTFSFQDVKLKVTKKDVVDFQASKVKVLKSVSTCLETRLADFGDDPIIKAAKILDPIG
YPSDVQEAVDFGIDEIHTLCDHFRPLLMAKGCEVELVEVEWMKLRQEAKKEKFQDLWKNV
LVHQGDVYPNLCHIIRILLVLPTSTAQVERQFSTIKRCQGDWRLSLSTATITDLLRISNE
GPAPEEYNPEAAVQHWFVTSNASRRPSVQPYGSRVTTPQATDWSASESDGSSD
Download sequence
Identical sequences W4XMZ9
SPU_004779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]