SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006433 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006433
Domain Number 1 Region: 281-361
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000348
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 106-176
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000341
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_006433
Sequence length 459
Sequence
MAPAPGPAPPAPSPYPTAAAAAAAAQMLDGQVSSLEAASAAAARINAMLISKGKLKLPPG
IVPLEPDTKQQKQVKLPVKEEKGKNETLVAEVEINEVPIQCRNMLTKGSTQEEISRLTGA
AVSTRGRYMSYADRATNNMGERPLYLCVQGPTRESVDRAVEHIKALIEGGMQGKQGGAPT
VNRTRSRFSAATTGPAGAVNTRPQGVPIFSHPPAPGLGAQMRGPALGGGDVRGPGVAGGA
GGLRGPVPHPMVPPPAIQLAIQTAQSSGHYLQDKVFVGMEHADPSFSIKDKILGPAGSFL
HHIRAETGANIYLRGRGSGFMEPTSGREAFENLYIYVTHPKVDGLQAAKKLCENLVVTVR
QPSPQVVYDVEGSVTQRRNSILTILRKSVLCVTEHLGQEFSLCVSWKAHIFLNILISNKI
WSYAFVSLNPRCNGDATIHGSFSFANLCFIYLKVWDMNY
Download sequence
Identical sequences W4XSN5
SPU_006433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]