SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006531 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006531
Domain Number 1 Region: 64-169
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000765
Further Details:      
 
Domain Number 2 Region: 317-424
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 171-269
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 427-529
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_006531
Sequence length 536
Sequence
MIVDPVKDNPSLQNCQIALCNWILFDMLIFIHPFYSCYQCADITTEASTILSTDIQYSTN
GADSLAVRLINGSSSNASGRVEVWYNSTWGTVCDDGWDLNDAHVVCRMLGFFNASSAPVS
AAYGAGSGKIHLDEVECTGSESSLEDCIKNKFEDNDCNHSEDAGVTCGGDQLKVRLNGSS
NATGRVEVLYNDTWGTVCDDGWDLNDAHVVCRMLGFTKASSAPVMAACGAGSGKIFLDEV
ECTGSEERLGDCITSRFGEHDCTHSEDAGDLTMANWEIVSFRLILSIILLSHINGVSNID
SEPDDSDTWTSGDIGSQLEVHLVNEPNNAEGTVEVRYNASSAWGTVCDDGWDLNDAHVVC
RMLGFFKASSAPVMAFFGAGSGEIHLDEVDCTGSESSLENCIKSEFGVSNCDHSEDAGVI
CTEHIDLEVRLTDGPNNNSGRVEVFEEGSWGTICDDGWDGRDANVVCKWLGFFGAAYAPV
QATYGEGVGDISLRNVDCIGTESNLGKCFHDRPERFDCAHDEDAGAVCLVLIPGII
Download sequence
Identical sequences W4XSY3
SPU_006531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]