SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006814 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006814
Domain Number 1 Region: 121-181
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 188-237
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000392
Family Hairy Orange domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_006814
Sequence length 498
Sequence
MAKNNVKWKFVKRFHQRDIYKNRAESIKNESLALSILNRIKIKANSNNMIAPINEVLFEA
DEGMTCGGAVHTYRARECLVYNHCTALRPFNIAMHLFVCFQRAVYFSKMPVDTKPKIHEG
SGRKSSKPQMEKRRRARINDSLGQLKALILEATNKDSSRHSKLEKADILEMTVKHLRNIQ
RNQLTGPLSSDPNMVSRFRQGYSECVHEVARFFTNIENIGGPDMRLSLINHLANTCNPPT
PSPSSASSQPSPPTSPVSVSPIAPLHAGQPTVIFPSPAATPSPTMSTAVNTSQVTQPIRV
QISQATSTALSSSNGIVTSPVQQQQCVQSRVETVSPCNTNNVPAGHTQVLSGIPLGFPGS
LPSGGEITLVLPPQALAAGGQLPSHFIPVYAQSAPILASPTMSPASLGPVSAESPKAYAQ
VHIPPPQTQVNAPQQVTAVQTPTLVALPAPAPAPIVRPTKVAFQTLPQPLTPPKTVLHQV
HVQQSGEPVWRPWSHRRE
Download sequence
Identical sequences W4XTR2
SPU_006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]