SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_006872 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_006872
Domain Number 1 Region: 281-362
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000462
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 106-175
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000106
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_006872
Sequence length 831
Sequence
MAPAPGPAPPVPSPYPAAAAAAAAAQMLDGQVSSLEAASAAAARINAMLISKGKLKLPPG
IVPLEPDTKQQKQVKLPVKEEKGKNETLVAEVEINEVPIQCRNMLTKGSTQEEISRLTGA
AVSTRGRYMSYADRATNNMGERPLYLCVQGPTRESVDRAVEHIKALIEGGMQGKQGGAPT
VNRTRSRFSAATTGPAGAVNTRPQGVPIFSRPPAPGLGAQMRGPALGGGDVRGPGVGGGA
GGLRGPVPHPMVPPPAIQLAIQTAQSSGHYLQDKVFVGMEHADPSFSIKDKILGPAGSFL
HHIRAETGANIYLRGRGSGFMEPTSGREAFENLYIYVTHPKVDGLQAAKKLCENLVVTIQ
AEYMTHQSQIFQRSAPAMAAAHMIAAPPRPPQQPLAQQAIPQQQQPPPQHQQQQMHHPAA
LGLYSQAQPTVPAAASTVMSQTLAAQQQAQAILGAAQRPVVSAAVSIQQGIVYPHLSAQP
QLGLPGQPGLALQVRAPQPVPAPAPVPPPQRLPPPLPPVGVPAASQAQLYVTHVAVSQGQ
QNLVQAHAQGQQSLAQAHAQAAVQAAHAQVQAHAQAQLAQAQAQIQLPVQPQPAGGGLAM
GQPQQVLQQPLGPPPQQQQQQLQQQPQPPQPQQPVKRRFREDLPAERPEHHPPPMTNLGV
SPPGHSPLGIAGAMAAGHGSLLRMPRRPPEDRRLMPPPPNPQAMQEAARKRLMLPPGLDI
HGGRIPLPDEPRLKRGRGLVSYDTSGDSDEDEEAAGRARTRFDAGPHFQGTAPSIVAFDI
DGDVIGGILQRGEKGTGARGIPFLDGQELSYLIGGMTIMKHGAHINDITMC
Download sequence
Identical sequences W4XTX0
SPU_006872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]