SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_007790 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_007790
Domain Number 1 Region: 71-178,303-425,480-660
Classification Level Classification E-value
Superfamily L domain-like 4.42e-45
Family Ngr ectodomain-like 0.0064
Further Details:      
 
Domain Number 2 Region: 721-878
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-32
Family Toll/Interleukin receptor TIR domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_007790
Sequence length 884
Sequence
MAQMRLIPLLVLLYLLILTATEEMSSQHHGLHLQRLAHSRCSQGPYKRKISCTRTALKEV
PQDLYPGVEELDLSWNDFRSIFNSSFTRYQRIKNLNISYNRLLREIATGSFYDMPMLQYL
DLSYNWFLKSITSQMFKFSINLSHLILFATDLESVPGDILRWLPNLQLLDLSYNVMISHI
NITSCSSKTRILNIVFLFIKIKAFVPNTFRIDCEINSLSYQPLVETSISSIDPQTIAAIR
TRVLSFPNVRLRPDLWDPFFRGIGMSDIEELLLHRTKIAEIDQHYFALLLNKPLQVLDVS
DNELPDHNKMGFLDLPLVLTLIIDRCGIKNIDPANFARMKRLRVLHLNHNKIKRIINTNS
WNVDIRELYLAFNSLHYIRKKAFEGLTNLTKLVLRGNTRLTRLGLTSFTDLRNPLYLDVS
GSISIIIAGYIPKLETFVYSDCKDQNLPWNIDEIFSHSKLLKHVIMRNASLNNLWIPYVE
NNTSLFRGLRTVISLDVKKNPLKRLESGILTDLLLLQELDLSDCQLTEIEVNAFEGLQSL
QILHLEGNQLLDLPHGVLWNMAHLRNVYLEGNKLKYLDRDLFFNSSRLRNLTLARNQLTG
LNHSTFKPILKTLLSIDISENEITCTCNLKWLPIWLSGSITLLNEIDTRCSSASLEELEL
KPLMSFKPAELCGPNIALYCSLPIVTTWIIIVLVFAYRHRWFLKYKLFLLKMAVIGYREI
RDARDFDDYEFHLNVMFAEEDEGWVRYRLRPVLEELLPEYNRNVYGDNDLPLGMHYYDAV
HYVVEKSYKTIVLVSRAAIQDNWFIIQFRTAADQVNDTQIENMVVIFLEDIPDVELPFLV
RLYLSDRKPYLSWKEDERFQEYFWQKLIKMLKMNLRCNNVIPPE
Download sequence
Identical sequences W4XWI0
SPU_007790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]