SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_007859 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_007859
Domain Number 1 Region: 144-423
Classification Level Classification E-value
Superfamily L domain-like 3.66e-41
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 737-878
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-35
Family Toll/Interleukin receptor TIR domain 0.00011
Further Details:      
 
Domain Number 3 Region: 533-663
Classification Level Classification E-value
Superfamily L domain-like 1.85e-26
Family Ngr ectodomain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_007859
Sequence length 899
Sequence
MGIFIKGQFLLTILLNLISVCVCEEHVNSAIFTPYVIECPVVPLPTGNSSCQCDPPNITV
TDTDSLAAFQYVSCKLTPELISATNPDPFYFPRSRRVYIDCSWNNSLSYSGFLMSAVKEC
GDIAEEVDPFGDVDCFTPFNITADTYMGLPSLQKLTLALEDGISIKPDAFSPLKNLEVLS
LVQLDLKSLHPEVFRGLTHLRQLSLWDNDIRELPDGIFNDLQDLQVLSLRSNSITHISRD
LLKPLEFLNTLYLDDNNISSIHADAFRSMRSLEEVDLSRNNLDEKFSLSFLGTEKLLLSY
NSLTSFTEDTVPGVRGYTTSLDLSHNLISSISESVFQTDELLSSLSYVVLRNNRLESLPT
NVLRWARRLTFIDFSYNSLETLHDGLFDIQSNPLGEQRLAGNQLVVRLGGNPFTCDCRLT
WFRIYDGQDVWISDRDDIECFSPPNLNGIPLFSIRPEHFECPLSDSLCPEHCQCYEVMKD
LGLQTPRRVINVECESENLTRIPRGIPSNTSSLDLTGNIWNTLRKSMLDTRMPFLSDLTL
TRCSIVRIESGAFRLLNSVLQLKLDGNNFRNITKGTFQGLTRLNTLYLNHSSIRTIADGV
FLDTPSLTYLYLHGNFLTVLPAIQHFPQSLEIVSLQENPLTCSCNLISLQGLVKYTLEVK
GNVTCRERDGTTVSLANLDSSYCRKHGTSPLLAPLASLGAITGVLVVVLICVFLYKKNKT
LFQLMLLRYFPQDLSEDDANKPFDVFISYCQLDDEFVLRYLVPLLETEDEPSYTICLHHR
HFVPGDTIANNIVSAVAQSRRVILVLSDNFLQSDWCMYEFRMAHLQALHDRRNTLLIITL
GDISQDSLDPDLKAYIRTTTYLESFDSKFKNKLFLALKRGRSNQRTARNQIKLVDFDGI
Download sequence
Identical sequences W4XWP7
SPU_007859 XP_011665655.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]