SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_008228 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_008228
Domain Number 1 Region: 149-425
Classification Level Classification E-value
Superfamily L domain-like 5.02e-40
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 738-843
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.36e-31
Family Toll/Interleukin receptor TIR domain 0.00016
Further Details:      
 
Domain Number 3 Region: 534-666
Classification Level Classification E-value
Superfamily L domain-like 6.43e-27
Family Ngr ectodomain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_008228
Sequence length 897
Sequence
MEVFIKGRFLMFVFSILLNLILLCVCEEHVNSTLFTPYVIKCPVVPLPTGNSSCQCSPPN
ITVTDADSLAAFQYVSCKLNPYLISETNPDPFYFPRSRKVYINCSWNDSLSYSDFLKSAV
KKCGDIAEEVVSIGNDCFTPFNITADTYMDLPGLQKFHLALEDDVSIKPNAFSPLKNLEV
LSLVKLDLKSLHPEIFRGLTHLRELSLWDNDIRELPDGIFNDLQDLQVLSLMSNSITHIS
RDLLKPLEFLNTLYLNDNNISSIHADAFRSMRSLKEVGLSRNNLDEKFSLSFLGTERLLL
SYNSLTSFTEDTVPGVREHTTSLDLSHNLISSITERVFQTDELLSSLSYVDLRNNRLESL
PMNVLRWARRLTFVDFSYNSLETLHDGLFDIQSNPLGEQRLAGNQLVVRLGGNPFTCDCR
LTWFRIYDGQAVWISDRDDIECFSPPNLNGIPLFSIRPEHFECPLSDSLCPGHCQCFEIM
KDLGLQTARVIHVECESENLTRIPRGIPSNTSSLDLTGNTWNTLRKSMLDTRMPFLSDLT
LTSCSIVRIESGAFRLFNSVQQLKLDGNNVRNLMKGTFQGLTRLDTLYLNHSSIRTIADG
VFLDTPSLTYLYLHGNFLTVLPAIQYFPQSLEIVSLQENPLTCSCNLISLQGLVRYTLEV
KGNVTCRESDGTTVSLSNLDSSYCRKHGTSPLLASLASLGAITGVFVVVFICVVIYKKNK
IVIQLMLLRYFPQDLSEDDANKPFDVFISYCQLDDEFVLRYLVPLLETEDEPSYTICLHH
RHFVPGDTIANNIVSAVAQSRRVILVLSDNFLQSDWCMYEFRMAHLQALHDRCNTLLIIT
LGDLVVVVTIMAIAMVMDEEHWNLERVLQRHTAHVCALFTKNRKEKTRPRICYGFFQ
Download sequence
Identical sequences W4XXR5
SPU_008228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]