SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_010619 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_010619
Domain Number 1 Region: 504-665
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.15e-34
Family Toll/Interleukin receptor TIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 44-448
Classification Level Classification E-value
Superfamily L domain-like 1.34e-31
Family Ngr ectodomain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_010619
Sequence length 670
Sequence
MANGSILYSLFVACLLVKPSFQSLHQLDGDSPMTSLTLDMDKSVHECDQNLELKTASCSN
LDTVPENLSEDTEVLDLSWNNITKLLNSSFEVYPLINSLDISNNDVRAIESATFYPLKDL
THLFLSDNPHLVLPATGVFMMSSQLLFLNLASSKLNSLPNDILKWSPRLDSVDLSFNNLS
FINVSSCDIADNVYMVNNRLQHLTARNFTFVCQTDFLDLRLNPILSVDPDVIASLDVRFL
ILGGYPLSYEVLQNIILGLSKSDIEQLTIMDGSVDEIQPDFFDGMNALKVLIINFNQVKQ
INPHNQTWKVDLSEFYLCGLESLQKLSLEGNDIHHIHDDVLSSLGQIQIINFEGNRIVYL
EELMFSNNWKLTNLSLTDNKLTHLNQSTFEPIFSSILSLDLSMNPINCNCDLKWLIDWLN
GPIRLKDKENTICSLESLEPLREKPLLDFNPNELCIKNYGLFSLIPLVSISLVVIIVLLY
HYRWQLRYKRFLLKLAVLGYKEMRDARDHNDYEFDVNIIFYDDDEDDDEWIREQLRPALE
ERLPQFQRNVFGDQDLVLGMHYLDSVDYVVSHSYKTIIVLSRAAVHDHWFILKFRTAMDH
VSDTLTEFVVVIFLEDIPDDEMPFLSRLYLSDGRPYIHWTENVRGQQYFWDELTKNLTIN
RRTNDLIPNE
Download sequence
Identical sequences SPU_010619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]