SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_010897 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_010897
Domain Number 1 Region: 231-296
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000302
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 134-217
Classification Level Classification E-value
Superfamily PX domain 0.00000017
Family PX domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_010897
Sequence length 315
Sequence
MKNSVASLAALRGKRLRKYSETDASCERLSGSIKSEGRSSQLYTKVPLTPLAVDDNEDYN
FKRQASVRIKKMTSCHDGSSLFPKLNDCAHFHYDHVELGAVQISMHEESDDRTIVEQNGG
AVDLLDCPFTLKMQSQGKVWLLKRCYEDFRVLDKQLHKCIYDRRFSQLVELPKGETLTGR
EAVKTMLTHYVTRFSQIAGDMINCGPVLNWLELDNHGNHVVASEESAINIPAVAAAHVIK
RYAAQAPDEISLEVGDMISVIDMPPPEDTSWWRGKNKFDVGFFPRQCVEIISEKLPLAVA
ERVPKGPKPGKYSLF
Download sequence
Identical sequences W4Y5A1
SPU_010897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]