SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_010940 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_010940
Domain Number 1 Region: 76-182,278-392,471-657
Classification Level Classification E-value
Superfamily L domain-like 8.5e-45
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 718-864
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-34
Family Toll/Interleukin receptor TIR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_010940
Sequence length 876
Sequence
MANGSILYPLLVACLFVSSSFQSLHRHDGDSAMPFLTLDMDKSFHGCDQYPELKTADCRN
KDLDTVPQNLSEDTEVLNLYGNNITKLLNSSFEVYPLINSLVISFNDMRAIEVAAFYPLK
GLMYLDLSYNRRLVFPTTGVFVMSSQLSILDLRGSNLKSLPNDTLEWSPHLDSVDLSFNQ
LTFINVSSCGMVDNVDMTGNRLRHLTARDFAFGCRTDTLDLRDNPIKSVDPDVIASLHVR
SLVLGGYPLSYEVLANIILGISRSDIEQLTIEDGSVGAFPKGFFDPLRDSSLSILNIYNN
ELKNLYPLVFSNLTKLKQLRFNDNRLPIGEIQPDFFDGMNALXVLAINNNRTWTMGLSEF
DLSGNLFTEISAAVFRGLGNLTFLDLSWNSQLSVVQLTAFTGLDNIQTIDLTLSSLVVLE
LYAPLLRSLSLNSLGPESLILQPGISFQHLQSLVNLDMEDSKIFQYSLWNTTANASLFDG
LFNLKHLDLSKNSFRSLPSGIFRQLSVVQELNLDYCKLTNLHPLVFSGLESLQKLSLNGN
YIQHIHDDVLSGLGQIKSISFDENRIEYLEELMFSNNCKLTNLSLASNRLTRLSQSTFKP
IFSSILSLDLSMNPINYTCDIKWLIDWLNEPIRLKNKDQTICSSASLQPLREKPLLDFDP
NELCIMNYGIFSLIPLASISLIVISVLLYHYRWQLRYKRFLLKLAVLGFTEMRDARDHND
YEFDVNIIFYDDDEEWIRRQLRPAFEERLPQFQRNVFGDEDLVLGMHYLNSVDYVVSHSY
KTIVVLSRAAVHDHWFILKFRTAMDHVSDTLTEFVVVVFLEDIPDDEMPFLARLYLSDGR
PYIYWTENLRGQEYFWAKFTKNLTINLRTNDLLPNE
Download sequence
Identical sequences SPU_010940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]