SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_011823 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_011823
Domain Number 1 Region: 131-426
Classification Level Classification E-value
Superfamily L domain-like 6.23e-43
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 2 Region: 531-674
Classification Level Classification E-value
Superfamily L domain-like 6.32e-30
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 3 Region: 758-898
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.35e-28
Family Toll/Interleukin receptor TIR domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_011823
Sequence length 912
Sequence
MIPATFSLSCNVPDLPCLCEGPTQGSGDHIEYHRITCFLTGEWNVTIGVIPLTRSLILSC
SHGGNGTEEPADLKEDLFHKFAGVLQNLTMRRCKIGNLPTEIFTDLILLQRLLLTSVDLN
GERLSAIGGIKTNASVKLYSNKLHSLNSDSFGNYFSNVSSLDLYSNSVQEIGNGTFAMFP
SLRKLFLGNNTISVVKEGAFSGLQRLSELNVRGNPSMFDGSWCLFKNVPFLTTLDVSFTG
LTNATQFNCAPLVHLRRLLIHDNNLTKLDGSVFALMPNITFIDVSNNDLEYIHSSAFHGG
LNGLNHVDMSGNHLRDFPILAFESTPNIKSINISYNYLRVIKKGTFSGQASLQTIDLSFN
RLHTIDMFGFVALDNLTMIDLRHNNFAIFPENVVWPFDIQPPHIPIKTFLQGNNFNCGCH
WMFYIRRGEFKDTYPFFILSDNSTWTCKAPSPVANKPMMTLPLEDFWCPYYNDEACRRGS
CECYSRDVDEANVFFCNNNTMHSLPNFPANTFMFECDGCLIDDQVTLQVGAFQASARLTF
LVLQDIGLERILPGALQEFPNLQQLDVSYNVLNTFSDDIITNLTHLHTVDLSNNRVNSLN
SNTFATNLNLTTVKLHSNNLKTLEDGVFNSTTYLEVLTLHNNPFVCNCSLFWLKQWLQSH
LDVVPQLYDVKCYVNSSNPDLYPIIQVADLDFGCYNPDVLTVQEYNAVIVTSTLTLLFLM
VGAVTFRHRRAIRVILYTRYGFHVLHDDDDDDVVLDNVRWEYDAYIAYSDEDIQFVLENI
IPILEDDDNLRYKLCVRHRDFPPGGCIATTIVTSLEASRRSIVLISRSFLQDEWRLLEFK
TAHQRVLKDKRNKNLILVFLEDLTKDEMDDDMRYYVTANAYLSTTDRLFRENLLYEMPRR
PLGEIHGDVDER
Download sequence
Identical sequences W4Y7W6
SPU_011823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]