SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_011949 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_011949
Domain Number 1 Region: 72-176,300-423,481-643
Classification Level Classification E-value
Superfamily L domain-like 6.12e-43
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 729-886
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.62e-34
Family Toll/Interleukin receptor TIR domain 0.0025
Further Details:      
 
Weak hits

Sequence:  SPU_011949
Domain Number - Region: 187-232
Classification Level Classification E-value
Superfamily L domain-like 0.00129
Family Internalin LRR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_011949
Sequence length 892
Sequence
MAYKHPLLILHLVIILTQTLHGVATLVPFRSLNLDTSLQGCEEDFERKTVFCVDLGFNSV
PQHLPEYTKGLWLMRNNITSLLSTSFRRYPHITDLDLSHNDIRVIESTALYPLKDLSRLD
MSYNFQLVLPGRGFFRWARKLSLLDVSHSKLTSIPNDILKWSPNLHTVFLNDNLLTVINI
STCGTARHVDLSYNSIENLTEYAFNFVCNSNILDLTGNPIRSVDPSVISSLHVRSFILGW
HKLTIEELRNIFIGISHSLIKTFKLTRGADLSVVPEDLFYPLHDCSLEILDLDTNQLYAP
YPRVFSNLTSLRQFHLQNNGIVTIEQDFFEGMHNLRVLDLRYNNIKDINTNNLSWTIDLT
ELNISRQYLFTSRPTIIRKSAFRGLHNLTLLDLRSDKFLDTLEATSFLELKSIQTIYLSE
CDIEPFKVMIPSSVTSLFLNDMVNPLGLENLTTSFKNVQLLEHLEMRQSGLLRHNLWNPK
VNVSLFDGLFNLTTLDLSENWLYVLMDPRILQQLSALQNLSLEDCHLEHLHPQALTGLKS
LRVLILRKNKLQQLHSDLFKSLYQLTSIDLADNFLMDLDGALFLSNRRLKTLLLSNNKLF
SLEQNTFKPIYFSLLFIDLSMNPIDCNCDLSWFLDWLNGPLSLTFVDEDDFDDDKTICSS
ASLEPLRGKHLIDFDPREFCSINIALVCLPTLAIICLIFTVALVYHNRWQLRYRLFLFKL
AAVGYEEMRDARDHNDYEYDLNVIFYDDDEDWIREHLRPALTEQLPQFQRSVFGDADLIP
GMHYLDAVDYVVSHSYKTIVVLSRAAVRDRWFILKFRTAMDHVSDTLTEFVVVVFLEDIP
DDEMPFLARLYLSDGRPYTHWTEDVRGHEYFFDKLTKNLTINLRTNDRIPNE
Download sequence
Identical sequences W4Y890
7668.XP_001190665 SPU_011949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]