SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_016457 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_016457
Domain Number 1 Region: 397-662
Classification Level Classification E-value
Superfamily L domain-like 2.72e-36
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 29-209,261-444
Classification Level Classification E-value
Superfamily L domain-like 1.26e-31
Family Ngr ectodomain-like 0.0067
Further Details:      
 
Domain Number 3 Region: 712-856
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-31
Family Toll/Interleukin receptor TIR domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_016457
Sequence length 869
Sequence
MTRMSGLYSILFVIITLTSIHRRATIEAASCQQDLSLKKAFCSDKGFRSVPTDLLPDLRE
LYLQDNLLTTLTNETFARYPSLRVLSLGNNNISRIEEGAFNPLTNLVRISIGDNLYLPIL
KKSMFSSQSLADFNAASSNLKTFAGDIVACLDQETVLKLTGNKLRKINWTSSNILSDVYL
DTNRFRQISKESFIFNNHINTLTLSTNPIEFIEASVISSFHVKQIELGNTRIAVSQLSNF
FHGIRLSMFIKGFDCIGTKLHTIQNGFFAPLKGKNLDKVNIQLNSINMLEENGFDGLSGV
SQLQLGWNNLEEIEPSVFNGMTAIRTLSLIGNIIQTLNSKSTPWNISLIHLNLAHNELTT
IDGSAFHGLKTLKTLDLSCNYKLQVMKTNTFADFKVLSELDLSETHILELPLHHLPLLAT
LILESSYCPTSLIRPGNLADEAPSLTTLNLIKNELGLGEVWDSSDNKSSFYGLQNLSRLD
LSSNPLLSIPLGIFQNLSNLQILRLDECSFGVLEKGIFIDLKSLVLLSLENNHLKVISTG
SFDKLYDLQYLLLLGNELTYLDSNLFKYLSSLVFLDVSENRISGLNSSTFEPLARLTALG
LSLNPLVCNCDLKWLPGWLKGKVELIDSIGTTCLDNTVTLEPFRGKQLVTFDPRDECGPN
IILYSCLAMLGMVLIFALGLIYYQRWWIRYRLFLLKLCFIGYEEIHDDVDRGEFKYDIAI
MLDEADDMWANQHLRPALLERVPDFNRIVCGDEELMLGMYYLDAVHYATEQSFKTIFVIS
HAALQDQWFMMKFRTALDHVNDSGTEKMILVFVEDVVDDQLPFLIRLFLSDHRPYLVWPD
DERGRDYFWEELIRDLKVNLRCNHLIPPN
Download sequence
Identical sequences W4YKZ1
SPU_016457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]