SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_017671 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_017671
Domain Number 1 Region: 16-163
Classification Level Classification E-value
Superfamily SIS domain 0.000000000117
Family mono-SIS domain 0.012
Further Details:      
 
Domain Number 2 Region: 463-525
Classification Level Classification E-value
Superfamily SIS domain 0.0000000834
Family mono-SIS domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_017671
Sequence length 607
Sequence
MDSPKQVPPPWKAERPVTELSNRKSENIDTATVPEIINILHDCEEEMFIGWQNYQRLHDK
DFVKKLSEVSKYAAALIKNSADSAIILSGCGTSGRIAFFIATKMNSLLKERGFPQCFDYI
IAGGDRALTHSVEAFEDSPEAGKDELIKVSKGKRKILFIGISCGLSAPFIAGQLHHCMSH
LDTFLPILLGFNTIHMIRDRTIEGWDHTLLTVTKHLMLLESSGQGYILNPIVGPEAITGS
SRMKGGGATKLILETCFLTALSYLSVSSDPKDNDEINADKDAANDSSKQEKLITSLFECY
KQVWETSYPTSKEQLSKLIEQAGKSKIVLNSTNTPIVSQRVFGWYKCQIRTLPYGEKTKR
YNTAVGQDPLEDETSLEFFKKSVLPSITAKDTVVFLVPSNDANIYHELNILLKSVMQKTQ
HIGMISSPLVDETQLDLKSCTVVPLGHLKEEMINKIQDGGLDSELGNVVVKSVSELALKS
ALNAISTGAHIAKGKVYQNFMVDLRLSNSKLLERGIGIVSRCAECSTEIARDAVMRAIYR
TDDIASFRDTPVSSIIQTAGNVERVVPIAIILAIKGCTVREALDHQERAPVIRTSLLNLL
QPPSTIS
Download sequence
Identical sequences W4YPE4
SPU_017671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]