SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_018534 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_018534
Domain Number 1 Region: 30-424
Classification Level Classification E-value
Superfamily L domain-like 3.54e-49
Family Ngr ectodomain-like 0.042
Further Details:      
 
Domain Number 2 Region: 509-666
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.35e-33
Family Toll/Interleukin receptor TIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_018534
Sequence length 671
Sequence
MNIDTLSVTGCRIRNIFKIDNSSLSNASFPAISSIVMSRNIIAYIPPYAFQGFNQTRTLK
FQGNKITTMFVDSFCGLDSLMYLDLFNNRIKSLKIGMFSCNPQLQELILSRNEITRLNIQ
SFQGLSALHTLDLSYNSLKRVDDRQQWDNPALHLLNISNNNFITLHPRLFSGNLSNLQIL
DVSFNKINDYSNVTFNNVPSLRELYLISEQVQSLNKVFSQMKNLTKLDISQADTSWTSIH
QFTETTSLQELRMCHNYLHYYDLFDKNVTQSSLFEGLVSLKKLNLMDNDLNGLEPGVFRP
LIQLHSLDLSQCKIVYLKPGLFQGLISLKTLYLNENAITTTFASFFKGLDSLKSLFFQNS
RLQVLDKNLFVTTPKLHYLYLSGNHISKVHRETFFPTNHTLRIDISDNRFACTCELNWFI
TWLQKSDIILKRPNQTQCYNTSFKAVVGKPILMFIPADFCGLNILLISGMSFLAFAVSLS
LVIAYNKRWWLNHKLFLLKLAIIGHQEMAEDFNADQYEFHLNLMFHEAEEEWVERVMKPA
LEERLPHLQNIVYGDDYLPLGMYYINAIHDVTENSFKTVLLLSNQSINDTWFMTKLRIAL
EHINDTGLDKVILIFLEDIQDDHLPYLVRLFMSKKKPYILWVEDEDGQELFWAQFERSMR
ANKAINNAIPL
Download sequence
Identical sequences W4YRV0
SPU_018534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]