SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_018782 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_018782
Domain Number 1 Region: 8-38,93-167
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-25
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 180-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-20
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_018782
Sequence length 441
Sequence
MGQNAWQTRSQLLAVLVIFWVYLFIGALIFTSIERRHADDLHRTFLVAAIDFVTNNSCVN
REDLQTYSNDLIDAYTGGLRWTPDHGFNSSKQQYHHWDLIDSLFFSATVVTTIGYGHLAP
STVLGRSVCIIYALIGIPLSGLLVTIIGQQLKKRLRGIWKRLLHRMHCITTGKSSPSHRI
ATITAVVISGFAFYVILIIIPACLFKYIEGWDWLTSQYYAVISFTTIGFGDYVAGDGQTL
SVVGHVVYKVLLIFYLLFGMGFVTMLLQGLQKRNAQKVEQFTKRRVIRRIMKRKRVRRKP
GLDDPDGIMLKEMPSESEEYVVITTDVVVGGESQGEDFEMQELESGVPFETVSVVDDIMQ
TQTIPSFDADTQTDWSKLDYSNCCCCCHKKPETNDGSTMTHTSSQSSSASSSESKVVNDP
DRTWKITENSVCPENLAEHGP
Download sequence
Identical sequences W4YSJ5
XP_781606.1.5271 SPU_018782 7668.XP_001185097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]