SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_019919 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_019919
Domain Number 1 Region: 31-461
Classification Level Classification E-value
Superfamily Sema domain 1.09e-61
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 468-518
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000746
Family Plexin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_019919
Sequence length 549
Sequence
MDRKKMGELLLFLILISCQTRSIQSAPLSSYLVSSFTPPGSDSTLPFNHIAINNITGDVY
IGARERLYQLDSDLNLKHTVNTEKCTDLDAGNVNDNKLLIVVTTPQKNTLLTCGGCDGYC
ESRSLTNISHDVMRYSKTSSQEVVTIGDVPTVGAVVLGSDFVDNGESTPNETFSLFTGVT
FKGRGTAQFISKHNLIDLSLVQNIQRGYVKSESLFKHLIVYKDYLYYFISRGNIVYLGRL
CRNSLDIELASYTEIELQCGSYNMIQSAHIGPAGSELGDSLNIDTTDALLYAVFSNESSS
FLCVYKMSDVQHSFESAVFGCIQGTSTGTINSNLLDTMCRSAPLLTLPDTVLCTAYYKED
NIPVPLYQYASGTVPIFASPIVTITDAIPTSIVATIERHHTVAFIGDTQGKLHKLNIVNG
SFGYVYENVSLGGGSVLQEVFLDESKEQLTLSTSSDQVSKVLTLDFVNCGQYQSCGECIG
EKGGNDGDPYCGWCTLDARCTRYEECPFPDESTRWLSYNALQCVSISDVHPDHRLPSQVT
EQEVGAIGT
Download sequence
Identical sequences W4YVR3
SPU_019919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]