SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_020996 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_020996
Domain Number 1 Region: 28-308
Classification Level Classification E-value
Superfamily L domain-like 1.11e-34
Family Ngr ectodomain-like 0.053
Further Details:      
 
Domain Number 2 Region: 426-568
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.41e-24
Family Toll/Interleukin receptor TIR domain 0.00029
Further Details:      
 
Weak hits

Sequence:  SPU_020996
Domain Number - Region: 320-361
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0838
Family Transferrin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_020996
Sequence length 593
Sequence
MNISMQVRLWVWVCCLLFVGRCTSLTFCDYCYCDTPDIVCTGVNFHEALNHTVPSRVASH
TKFLNVYTFAVNMILANDTLSVFPALQSLTISSYEVSFVDQFVFKRLYELSYIYLERNSL
HEIPSEVLFHLRISLQELHLVNQLLRNIPSNAFAELVNLQELTISYNLNYLDISSDAFNG
LAKLKGLCLSTCNIRHLPNTTFSGLHTLQELDLSYNRIVEVPTAIQTIKSLMMLDLSYNT
LLVNPMDLMFLRSTTKLQTLQMRYCAISKILPDAVDNLKASRDLTVANFDGNPFNCTEDL
CSFASWYVSLTGPSTSTRSPDFIPFITLSPPPGKGPYQCDNYGKPLKDFFSGSCLPRPDP
SPSIFPPGETPWHVVIIAVTVILVAFVVTIVSFVVWKFRLINYYHHRIGVSFQRHVDYGA
VGDNNHEYVYDAYVSHHDDDKSFVEDEMLPRLEDEHGFDMCVSFRNFRLGSNLLENVSSA
QDVSRAIIFIINERFMQNGQCKLELEMASTRMLEDETGHEGQRLIIILMEVLAPELVNST
LRVLLNHVAYLEWDPAAEERCWGQLIATLDTLVPERNAGDQADDNEHDEDQTV
Download sequence
Identical sequences W4YYS0
XP_003724492.2.5271 SPU_020996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]