SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_020997 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_020997
Domain Number 1 Region: 28-308
Classification Level Classification E-value
Superfamily L domain-like 1.5e-37
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 2 Region: 426-568
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-23
Family Toll/Interleukin receptor TIR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_020997
Sequence length 602
Sequence
MNNSVQVRVWVWVCSLLFVGRCTSLTFCDYCYCDTPDIWCSGVNFHEALNHTIPSRVASN
TTFLNVNIFDGEMILANDTLSVFPALQRLSISTYQVSFVDQFVFEGLYELSYIYLERNGL
HEIPSEVLFHLRTSLQELHLVNQRLRNIPSNAFAELVNLQELTITYNLNYLDISPDAFNG
LAKLKGLCLSSCNIRHFPNTTFSGLHTLHELDLSYNRVVEVPTAIQTLKSLMKLDLSHNK
LLVNPMDLMFLRSTTKLHTLQMRYCAISKILPDAVDNLKASRDLTVANFDGNPFNCTEDL
CSFASWYVSLPGLSTSTRSPDFIPYITLSPPPGKGPYQCDIYGMPLKAFFSESCLPRPDP
SPSIFPPGETPWHVVIIAVTVILVAFVVTILSFVVWKFRLINYYHHHIGVSFQRHVNYGA
VGDNNHEYVFDAYVSHHDDDKSFVEDEMLPRLEDEHGFDMCVSFRNFRLGSNLLENVSSA
QDVSRAIIFIINERFMQNGQCKLELEMASTRMLEDETGHEGQRLIIILMEVLAPELVNST
LRVLLNHVAYLEWDPAAEERCWGQLIATLDTLMPERNADNGEGTDEGRDDGDQADDNEDQ
TV
Download sequence
Identical sequences W4YYS1
SPU_020997 XP_011661983.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]