SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_021225 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_021225
Domain Number 1 Region: 53-400
Classification Level Classification E-value
Superfamily L domain-like 1.04e-51
Family Ngr ectodomain-like 0.028
Further Details:      
 
Domain Number 2 Region: 487-639
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-32
Family Toll/Interleukin receptor TIR domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_021225
Sequence length 647
Sequence
MTCTTSRIPICLWIACVLSLLSGALPGNDIAGKDGNWSSVSPSGCELTTTNLGTRAICTR
LGRRSVPQDLPSNTIVLDLSINMITSLYNESFTYLPDIITLALRSNQLSEIEDGAFGNLD
NLTKLILERNRLMSLPAESKIIKKYLLWGFPNLRILNMSHNEIQSCYSPKAFLNLKNLKE
LYLTNERFQIINGAFRYMDALCTLDLSGAGMEIHSILQFTNTTSLVKLAMRENRLRSKYL
FDRLTSKSLFFGLRSLVRLDLRGNNLDILAPGTFDPLKRLEILLLSQSSIKVLIPSVFDS
LTSLTRLDLSDNEISAIPGDLLQSQPRLGVFYITNNKLDSIHKTLFNKTPSLNQLYMQRN
RITTIEPGTVFPTNKTMSIHASGNPFSCTCDLSWFVEWLRSGNVELIHPDDTLCSLSSIE
DMVQSPILSFHPDQYCGINILIITGVSFSVVLVAILSLVAYRKRWWLNYKLFLLKLAIFG
YEEINQDFDAENYEYQLNLMYDEDDQEWVDQIMKPVLQERFPHLQKVAFGDDNLNIEMFY
IPALHYVVENSFKTVLLISNNSVDEAWFMTKLRIALEHINDTRLDKVILVFLEDIQDDDL
PYLVRLFMSKNKPYMLWTEDEDGQELFWAQFEKSMRANRVINSVIPV
Download sequence
Identical sequences SPU_021225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]