SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_022451 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_022451
Domain Number 1 Region: 382-538
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-34
Family Toll/Interleukin receptor TIR domain 0.00083
Further Details:      
 
Domain Number 2 Region: 47-247
Classification Level Classification E-value
Superfamily L domain-like 7.65e-28
Family Ngr ectodomain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_022451
Sequence length 544
Sequence
MAFNYGLFRLPFVICCLLLPLTMQTLRRDSLLTPSTFDRESLGCEMNIELKTASCGNRGL
NSVPQNISIDILRFDLFRNNITSLLSWSFKRYPLITRLDLSQNDIRVIERTALHPIKDLM
YLDISFNPHLVLPGTGLLRWARKLSNLNLQSSNLQSLPNDILKWSPRLEYVGLYRNHLKV
VNVSSCGTSEHVTLSYNQIEHINADDFYFVCHVGYLNLQGNPILSVDPNVVASLHVRKLF
VGDYPVTFESFRDLFSGISHSEIKEIVIMNASIVAFPDNFFDPLRDWPIHLLKFSNIGPI
QLLNEDETICSLASLDSVGEKPLLDFDPSELCGLNIVLICVLSLAAICFVVVVGFVYHNR
WQIRFKLYLLKLAVLGYNELRDARDHNDYEFDLNIIFYDDDEHWIREQLRPAFEQRLPQF
ERNVFGDDDLVLGMHYLDSVDYVVSRSYKTVIVLSRAAVRDRWFMLKLRIAMDHVSDTQT
EFVVVVFLEDIPDDEIPFLARLYLSDGRPFLHWPNDERGQEYFWNELVKSLTINLRTNDL
IPNE
Download sequence
Identical sequences SPU_022451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]