SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_022575 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_022575
Domain Number 1 Region: 41-185
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-20
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 2 Region: 460-533
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000678
Family SH2 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_022575
Sequence length 545
Sequence
MEQGYYLDLNLDQVDQEEEEEDIEEVEEEEEEPKCDPPYVISKIQSSNLIEDIKKISAHD
ILLRDVMHSGFLYKKAQDRKVDVLGEVGEHVGRVLGFQDRSRRWQLRYVIIYQHYVLYFR
DDKAKKPQGVFSLTGYNRVMRDEAVSDERKWSFKIIGLRSDSRTWYFNAASEKEMKLWMA
YFKVAMEQAIHGKAREKSLKILQDLKYKNSHRDTLFEDESRHSGSSSGGSTSGSNDPLVY
EDIEMPLYDDTASPTSPNAPLHRPLPSLPTDDFDSCPRRSSAGAMSGIKRPNQLSTRSPM
DADQADFDEDYITPEMDAQSPSRPLPPTPGTPKMGQMIMPMGKSLQQELENRKRREPSKR
LTNRQPSIEEGSEEDKPTLRRGPEGNSFRKPITERPFRGPEPVLKPLVSAKPSDAIKPAT
RPKPKIITPKPPVKPRPSGGPAPAVLLPEAASIQSSDKIHTEGLLRKYRCDGMYLVRLGS
EHGQVLMVWDSQNCRCKHYKIFQDQDSNLHLDHVPKFDNILKLLEHYKTNALPNSKLYLQ
KAFAG
Download sequence
Identical sequences W4Z378
XP_011683589.1.5271 SPU_022575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]