SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_022698 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_022698
Domain Number 1 Region: 10-56
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 0.000000458
Family Nicotinic receptor ligand binding domain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 67-149
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.000017
Family Neurotransmitter-gated ion-channel transmembrane pore 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_022698
Sequence length 212
Sequence
MRISVTPASDTIDLEDYNAHPVWELVNTSAVKNVVRYPCCKEVYEDISFHLTVRRRDSHG
RIASAVIATWLILVVFLIGPSSAGERIIFAGFVFVALVVLSAALSAEVPAYSMTRLGRFL
IGGMLINAVVIIINGLIYRFYPKDQPGHMKVRKVIFPSSLGYQFILANFSKSFYPLVSLF
TLMVSAFSESSFSFQTSFLIQPSSISCSVKRN
Download sequence
Identical sequences W4Z3J9
SPU_022698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]