SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_024404 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_024404
Domain Number 1 Region: 83-186,309-428,487-667
Classification Level Classification E-value
Superfamily L domain-like 7.82e-55
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 733-878
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.03e-31
Family Toll/Interleukin receptor TIR domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_024404
Sequence length 890
Sequence
MFQSKRMASLTILFSLLVFIPQVISRRDEMMTTTPGNESASLRVASALTSGMCDYDVTEK
KAYCRNKGLASVPGDLPSDTLRLDLSLNYIRNLQNGSFIRYTLLFFLDLSRNDITTIEPE
AFKPLQKLVILDLSNNPSLASGDAFEWLQQLKLLVLDGCNFTSVPDGSLRSSPNLRSLDM
AYNRLTSITITSCSDLVAPDFNFGYNGITKLTPETFVILCPMDTIVITDPIQFIDPAAIA
PLQAQNLIVGALPMAIEVLTQLFHGVAISGIKGLSAIGSGLTTIPPNFFSPLSNAPLSFL
DLSFNEINPLNHSMFSNLTNLYKLILSSNDIRAIEPEYFAGMKELRVLDLGYNEIHSINP
NDFRWTIDLDELYLHDNRLVEINSFSFHGLWNLTLLDLSNNEDLSSLEIKSFHGLGNLAI
LDVPGCNLQVMSLWSPLLTSFNIWHQVPYFGDGSFIPGETFKSTTLLELMDLTGSIVTIN
SLWDSSRNLSLFHGLGYLRAIYLNNNPIGGLPRGVFSNLTSLTKLYLKNCELASIETGLF
SGLRSLKELHLEQNHLKHISPGLLQGLGQLLALYFDDNHISYISDDFFTESPLLTTLTLT
DNDLTTFNYSTFKVIKSTLSAIELVNNPIVCSCDIAWLVDWLSGPVRVIHADQTYCSSAS
LDPLKQKPLLTFQPEKYCSPNITLISLLVLACIGVVVLFLLCYRNRWALRNKLFLLKLAV
LGYDEIEDVRGHSEFAFDLNVMCDDDDDEWLRAHLKPALEERLPDFDRNVFGDEDLIIGM
HYLDAIHYVVEKSYKTILLVSRNAVRNNWFLVKFRTALDHVNDYQLENMVVIFLEDIPDE
ELPFLVRLFLSDHGTYLTWTEDAEEQEYFWTKFVKLLKVNRKTNHVIPPE
Download sequence
Identical sequences W4Z8D1
SPU_024404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]