SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_024416 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_024416
Domain Number 1 Region: 449-645
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-37
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 863-1020
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-31
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 207-220,254-418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-30
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 4 Region: 653-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.32e-30
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 5 Region: 1056-1250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-29
Family Laminin G-like module 0.0000944
Further Details:      
 
Domain Number 6 Region: 3-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.25e-20
Family Laminin G-like module 0.012
Further Details:      
 
Weak hits

Sequence:  SPU_024416
Domain Number - Region: 184-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000376
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_024416
Sequence length 1551
Sequence
MSIRFLGTENTFARYEEWNRTVNGTLKFEFKTERRDALLLYTDDGGTGSKFFLELVLENA
QLQLRFRIRNKARTIIIGEELSSNTWHKVTLMKSPEECVIILNGERKSGAIPDGQASLTG
SSDLFIGGVPRILPLTYISHPEVKFLNRFEGHVRNLVYLVSERPKRWYRPESMAANGIDE
DPSDLCGSDDFCRNQGLCVSSDADAECDCSGTGYTGLTCETRAVKRRRHNGNVTQCLVYK
GSNEEVVENCYTGKTATSATFDGNTYISYSLIKKKISNNRDEVLFEFRTQSPAGLILSVG
EEYDYIYAAMNGGRIEIAINLGSGEYREFITARRGQSGFIDNEWHKVRITRENTEVTIRV
DESIMATGNTEGDFMRLGATREFLVGGAANPELVPGYREVSQNFRGNLRDVVYNGEDFML
ELLELAISGDDFTQVFGDITFTTEDVDAIDPITFLSEESFLLLPKWMAKTEGTLSLSFRT
NEPSGVIMYNRGADHITDFFALELMDGYLHLILDLGSGSIRYRADSLPLNDGLWHSVLLY
RHHNRGTLQIDNEDPGKFNVGGTSKHLNLVDHLVLGGIDFVNDSNFLPMDLYSGALRRGY
VGCLKNLVLQGTSIDLPSYALRQHTGNEIGVYCRDEEGQCPSTPCSHEGTCTEGWNRYIC
DCRITGYTGKTCDEVFTEEGEVARLSFNGNQYMRITVSANSRSKVEDIFLRFRTRFPDGL
LVATSSDNVIDMLMVEVKQGLIRVITNYGIGQTMITAGHGLDDNRWHAVHVQRRDDRLMV
TVDNTDRAEVSENFQSGILDYHYIEVGGVANRESMPDNPLNFVGHMEQFLYNNQPYFDMA
KARDLDYIRLNATFGEKMSQRPKVNPFTFRTKEVFVQLETPDSYPALTLFFHFKTTESNG
LLLYSSGGRTDFISVGLVEGQIQYAFNMGAGPVKIHANTPHMLNDNKWHEVSVSKNSGGR
HVLQVDNSMSIAQPSPKARHLDLTENLYVGGVSTDMYEDLQSGVEARVGFQGCFASLEVN
GRKQDLEDSAISIEMDKSNLKRGCEDNGDLCLADVCANGGLCIPGWNGYSCDCRMTSFSG
VNCSGVSTSFGYGTGGGVISLEIPESQWLRTDHDDLSMGMATRSANAIIARIDSATSDDY
IEMELVNGYLWTMYNFGSADHMISDDTNRINDGSYHVIHFSRTGANASLQIDQYARIHKT
PKGKQSTFFDDQAIINLGGRGEMSDSKRKRRRRAPASSQFEGMMSGLSYNDMRVLDMAAS
DDPRVVLSGNVGELENPENYIYGTPIPTTSDESTIYRITTTRKTPVLPPILNVSSTANSD
LTSPTKITMSIAPTSDGEYTPDDQDIIFVTGSGCMSDVPEDCTPQAAGEDIFVPGETMST
PPPDKPGAPVTTESASPMSPQPLPPSSTEPGSGCDDDDEDCMTASGENSGTKPSPTKDFT
FTPVDATGVTVAGSTPQSGASQGNNGFDFLGEAGLVVGAVSAAAVIFILVILAIYKFKNR
NEGSYQINESRNYDYEATRTSLLPATATNGTLPSKPKPSLPPEYATKEWYV
Download sequence
Identical sequences W4Z8E3
SPU_024416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]