SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_024429 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_024429
Domain Number 1 Region: 76-182,307-645
Classification Level Classification E-value
Superfamily L domain-like 1.14e-49
Family Ngr ectodomain-like 0.052
Further Details:      
 
Domain Number 2 Region: 710-856
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-32
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_024429
Sequence length 868
Sequence
MSFKHHSSLFPSLVMAFLLPLTLQAFQGDSMEIVSSGLHTGSVRQGCHQDLQQRKANCTY
RNLDSVPQNLAEDTKKLDLSYNNITVLQKFSFKRYPLITRLDLTGNDIRVIEPTAFHPLK
KLVKLLINYNYNLVLPVTGLFRWASKLTYLGLSKSNLKSLPNDTLKWNQYIDYLDLRRNH
LTFINISTCGSVGTANFYDNHIEQLTKETFTFACQTDYLYLGGNPIKLIDPIAIAALHTR
KLNLGYTGGHPWTPEMLRNLTIGISRSQIIKRLGVTGDLSFFPQDVFTPLRDYSFTLLDF
SYNKVALYPFVFSNLTLLDQLNLRYNKIATIEPNFFGGMQALKVLNMDDNQVRSINTCNH
TWTINLIELYLSRNSLTEISKFAFLGLQNLTLLDLSYNQQLTSIDLASFTGLDNIHTIDL
SGCSIRHFQLYTPVLKSLVMKGNFVYLSGINPLNPGKSFKNSTNLVHLDIKATQLRSHNL
WDPARNVSLFEGLFNLTTLDMSKNRRIGILGLLPGTFHHLSALQELNLDGCAISNLHPLV
FTGLESLQKLKLSGNKLNQIHTGLLTGLALTSLSLANNKLWGLNESTFRPIYSSLSLVDL
SQNPLVCTCDLEWLLDWLNGTLSLIMGEKTLCAPSSLAPLREKPLLHFNPTELCRFNTYH
AIFSLIPIVILSLVVFLMLVYYKRWKLRYKLFLLKLAVFGYRERLDARNHNDYEFDVNII
SYDDDEVWIRENLRPTLEDQLPQFQRNIFGDADLIPGMYYLDAVDYVVSRSYKTIILLSR
AAVRDRWFMLKFRTAMDHVSDTQTEFVVVVFREDIPDDEIPFLARLFLSDGRPYLHWTED
VRGQEYFWKELAKNLTINLRTNDLIPNE
Download sequence
Identical sequences W4Z8F6
SPU_024429 7668.XP_001189281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]