SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_024994 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_024994
Domain Number 1 Region: 236-288
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000524
Family Ovomucoid domain III-like 0.0074
Further Details:      
 
Domain Number 2 Region: 163-212
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000236
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Weak hits

Sequence:  SPU_024994
Domain Number - Region: 87-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000171
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number - Region: 15-48
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000373
Family TB module/8-cys domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_024994
Sequence length 394
Sequence
MSTVVAISNTRGGKRGGVCWSSPPNGNPCSQLIKLHLSKEECCHNQGPTISWSREDLDLG
KLMRTLLTSRIALSECIPCRETCEEMQCRDDQKCIIDHNNRTRCVCQPHCENIEYEGAVC
GTDNYEYGSVCELLTERYSCDGVTCPRGRRCVEDQAGRPHCVLCWAVCRYHIRDTQYVCG
RDQITYESLCHLRLSSCLIGKAVGIAHEGRCENFTSCSALSCVRGNQCVMDPIEEEPRCV
MCNITCPERWLSGPVCGSDGVTYPTQCHLHNHMCANDTYVEVDRRSPCNVETANSGEESG
SIDHTTFLDIVEPIAVPLDQVNNTGRSLRQRSNPIEQVNNEVEDVTTEIYDIETTIVTEI
EDVEDPQVSTDGDGRDGEGRSNKEEAVVERDGEA
Download sequence
Identical sequences W4ZA17
SPU_024994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]