SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_025323 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_025323
Domain Number 1 Region: 112-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.93e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.00075
Further Details:      
 
Domain Number 3 Region: 79-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000348
Family Glutathione S-transferase (GST), N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_025323
Sequence length 239
Sequence
MPQYKLMYFDARGRAEVIRMLFTLKGVEFEDCRMKREEWPAMKDNKEMFPLGQVPILIID
GKTMPHGKAINRYLARNLVFPLGQVPILIIDGKTMPHGKAINRYLARNLGYYGKTDEQTN
VIELVSESVDDIIQKIYPIYYDKDEEKKAKNMQEFKDTVSVPQFKYLISLFTQTKGPFFC
GDEITLADLIAFTIFDAIILTMRITDILDPYPELAAFYKRFNEDSPLSSYIKSRPVTFF
Download sequence
Identical sequences W4ZAZ5
SPU_025323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]