SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_026362 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_026362
Domain Number 1 Region: 724-821
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-20
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000156
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPU_026362
Sequence length 860
Sequence
MAHGLKRISYATCDPDYGQFAFLARNPKGPVGVQYCHVFITQEDYEAEEINAIISKAFKV
AYASIRSKKQFYELVDELNREQEEYFTQITRLAEEEELKAKRPEVLMANQPVLSSDRVRG
FSVGQSKVWAKQQAGKIQHKQPHLIAAMEAPPTLPTQPCDLSRGPLPPLPASNHSGSLGS
RLSEPAGDPSMRDSWVIVDPDSEVDPDGRPMSPSAPPLSPKDAYSQEPVAKQTQKSKPLP
PAPYYEVDFYNEWSLQSALGRNSALSVVSETDSNTSCQILLQDEHPPPALIAGIAPAAAG
PHSTGQILLQDSSVPPPFVYGGRSGSENSFDDMTVDDVYAFENYKMDFTGRESVISAGSF
DEEANFRYQLKCAEQFINAVYDVDSTEEDFARPKLSFRDKLKRKDHSEREKENGHRQDDG
DSALGEDEAERRGNISHGSDDSVPCIQNGHVFKMTGDESEDESRERCRADYAVPRTPAKA
VEPSAPPRPPPPPTSQEEGPSERKRPVPAPRRISPEIVVSPPSSSNLLKVDPSGVAEQRP
LVPRRPSADSNVILNGAASIVAAVSPMMQSSSEGLSRSSSRSNVIDPTPSNAAVASSQRF
PQSQQSTMQIGQSNGLPQPRGAASSRYSDTNSSNNPRTQLDEARANSIVDTTYSGTPGSP
DKRSLRSPGHVGHKVEVEIGQFRCKKIPLKGGPPPLPPRSTSLTEIPDDDDEEEDTAQGK
GVVAPWFKAGIPKEIAFEILHQQEKGAFIVRESKSHPGSYALSMKVDTNFNDSSLANYLL
VRSKNGGYTIKGFGRDFPDLPQLVHFYTLHQDQLPCKLVISGTNPLYRQDAKGEMSDSDD
EEDPDYRRVTDYKVMLEGAQ
Download sequence
Identical sequences W4ZDX0
XP_003727756.1.5271 SPU_026362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]