SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_027790 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_027790
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000706
Family CAD domain 0.011
Further Details:      
 
Weak hits

Sequence:  SPU_027790
Domain Number - Region: 753-832
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.0837
Family Typo IV secretion system protein TraC 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_027790
Sequence length 1316
Sequence
MAASAPAPRMFKVWHAEDKKLVLAKSLDELIEKGLAKLQKAREHFKCLRLSDGTDVDDDE
LFAFLQESEPVHFVFNDEEVPSYDHQITDTSEGEDDVVSFSSSTSTSSRRSLVFSTASTP
SSHLLKSVPSTPTTSTSSKSVPSTPTTSTSSKSVPSTPTTSTSSKYVPSTPTTSTSSVDS
DSDTAAETNEPEIITTQAATHTSPLEKRHLKRSAATSQRQATIGEFLGGGSVQTVNFVKK
AKILREDGKNARYNSTVNKGCTEILNKNLFILTDKGGKGKLLKMGKEVVNKTYVFAKGKS
VSKKAKAIQGEGLNARWTKTARSERMQELEEELEGIKKDMQIAESNCNIKVSCEKFEEAE
SLRDKIKILQQRQRVCKIEIIDLQKRDHKAKRDLKYIQRKKDKEIPSDDDVQFVQADGSG
ATKHDDNSGATKHDVQSNQESGELTKPDDNSGATKHDAQSNQESGELTKPDDNSGATKHD
AQSNQESGELTKPDDNSGATKHDAQSNQESGELTKPDDDSGATKHDAQSNQESGELTKPD
DDSGATIHDGQSGEHFQSKLDLFLRESAKSLNIKEPANRVHECVQVSPIDNTISLKEYEQ
VRQYICKTHHRPIQEGLHCSLCSADINAASYILQNQPVKLSAVWKACYPTLKYKAYTASK
RLGKMPIVLVTLGKSGCQTIYVMEKDEKTNYSLFVQVLEKFRESPTCAPEISREKLATLK
KLASKEKDRRLITYAVTNHLSSKKAKHLYGIGNHQKNKNQVENALTEAEEIEAAYHSIMD
SEEHANQVMLSKPDQSSAVPQSPQSIRKRRQLKEKYRRKIKKKYDTLKLLKRATSNKSTL
LKRHPSIGKRIETIVRDSGVGADKWHSSGSLTWERKKVGQKITFQRLRQQLQEEYSEHIS
HGALVQLCVPRNSRHLSKTRYKSVANIVSKRARKGFDIKLNADEKWSNSLYKSLNILQKK
DNSNATYINRDDAAGFRLDTLATSRGDENPAHNETRFMWTKWHTDREKLATIVTTRYSGG
SFLNEVEHLNGQLSRSANNLFIPSTLCGNTRDISGEVDHDTVVANQNAARDVYIERVDKT
RYKDGEIHLFKCALGPDASEIQEQRNGLTKYLKSSNAAKRKLTETSPDELERFQYMDKIL
TIMDNHTVGNNKYVFRLVCCFKQDCPHPVCQSRPGDDPSSILWYPGGPSIMFFPWPVPDP
ERQPEHCTTCQPSCSGHFMHLDQLLENYENGIAADPSAYLASEQLAKVFEERRRVSDNLD
DAVPDEETQVLLSTRYCISKKMVSHTVNHLCQVAKNRKRGAEKAAATRAARRNDAR
Download sequence
Identical sequences W4ZHX8
SPU_027790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]