SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_027798 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_027798
Domain Number 1 Region: 76-182,278-400,482-667
Classification Level Classification E-value
Superfamily L domain-like 4.42e-40
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 730-874
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.4e-33
Family Toll/Interleukin receptor TIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_027798
Sequence length 886
Sequence
MENGKILYPLLAVLLLVSSSFQSLHRHDRGSAMPSLTLDMDNSFHGCDQNLELKEASCSK
KGLDTVPQNLSEDTEVLDLSYNNITKLLNSSFKVYPLINSLDISFNDVRAIESAAFYPLK
GLMYLFLAFNENLVLPATGVFMMSTQLSFLDLTSTYLKSLPIDTFKWIPHLDTAFLFYNR
LSSINVSSCDMADNVIMIGNRLKHLTTRDFIFVCHTDILDIRGNRIQSVDPDVIASLHVH
SLVLGGYPLSYEVLANIVLGISKSDIEQLTIEEGSVGAFPKGFFDPLRDSSLSVLDFNSN
KLNSLHPLVFSNLTKVRQFSFSNNKLPIDEIQPDLFDGMNALKILAINNNRVRQINPNNQ
TWTVDLSEFDLSGNLCTEISASVFRGLGNLTFLDMSSNKHLSVFELTAFSGLDNIQTIDL
TGSRITVLELNNPILRSLSLNSLRSFFLPLRPGKSFQHLQSLVNXDMKDSQIHLENIWNA
YSNASLFDGLLALNHLNLSSNHFLNFVYSGIFRHLSVLQELSLDYCDITYIHPRVFSGLE
SLQKLSLKGNNIQHIHDDILSGLGQIKSINFEGNRITYLEELMFSNNWKLTNLSLANNRL
TRLNKSTFKPIFSSISSLDLSMNPINCNCDLKWLIDWLNEPIRLMDKENTMCSSASLEPL
REKPLLDFDPNELCIMNYGLFSLIPLASISLIVISVLVYHYRWQLRYKLFLLKLAAVGYK
EMQDARDNIDYDFDLTIIFYDDDEEWIREQLRPALEERLPQFQRNVFGDEDLVLGMHYLD
SVDYVVSHSYKTIIVLSRAAVHDHWFILKFRTAMDHVSDTLTEFVVVVFLEDIPDDEMPF
LARLYLSDGRPYIHWTENVRGQEYFWDELTKNLTINLRTNDLIPNE
Download sequence
Identical sequences SPU_027798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]