SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_027862 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_027862
Domain Number 1 Region: 83-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-43
Family MAM domain 0.00033
Further Details:      
 
Domain Number 2 Region: 424-590
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-39
Family MAM domain 0.00056
Further Details:      
 
Domain Number 3 Region: 247-414
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-37
Family MAM domain 0.00027
Further Details:      
 
Domain Number 4 Region: 609-777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-32
Family MAM domain 0.0059
Further Details:      
 
Domain Number 5 Region: 778-900
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-23
Family MAM domain 0.0065
Further Details:      
 
Domain Number 6 Region: 905-1064
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000146
Family MAM domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_027862
Sequence length 1163
Sequence
MMKNEHFKSILNIDVTATLPIKPYVERSGWKSNRVNALPLIILTLMMKLDVPFRRRLQQQ
ENKMAFVLLSIFACLAAMCGVCVGERCNFDFNLCNYTQDTTDQLNWVRINGASSMDDTGP
SADHTHGTSQGYYVYTNAGFPQTAGLVSRLISPPIAVSAPSCLQFYYYMHGAHMGSLRAY
TGVDSSSPVWSRSGNQGRQWFRGVATLDPSSSANVQIVFEAVTGPGILSDIAIDDVEVLD
GACPIENMRCEFEDGICGFTQDQTDNFDFLRKQGQTPTVTGGPDVDQTYGNQTGHYIYIE
AKGNDNHGSDKARIISPKIRGIQANDREAFCVVFWYYMFGDTVGELNVYLRNESSPNLGR
PIWGLAGARGETWRAAEVELNTPEDFYVVFEAMRGISLYGAIAIDDIEITSYGCPGHHVI
KNVSSVSCDFEEIEICYYTLDSTGSISWVWTNRASPESITGPSVDHTTGNELGYFMYVSS
STLITSADRARLVSPVAKRQTTLSCVEFWYHLYGRDTETLNVYIKPEGEPLPSSSAWSLT
GNRGNFWHRATFNIPAFTNDYRLVFEAIPGDEARDDIAIDDVMFYEATPCPTRTTIPPDP
VTLPPAVNSIDCDFESNFCRYEQDSENDQADWAREQGKYVRSSDRGPHVDHTLGTGEGYY
AMFDPSLFQSLNRYDVAVLVSPFVQASNQPRCVMFYAFMYGSNVDYLNLYIRPWGTTPSL
DPQFSIYGNIANEWRLYGMDLPGSHENFHVLFEANIGRFKSSGKIAIDDIGMVTGNCPEQ
GHYMYIETSLPQRPGNLASLISPVLNSQNTDTCLRFYYHAMGEGDIGTLRVIFKLEGLSS
LVELFRVTGNKDDRWIPVNIDIPASSTGFADFEVRFNGYKGNSLKGDLAIDDIKFLRQPC
EGYPIEGRCSFEQGIEYCGYTLFTTIDVTFPTWQWYDRLALEESPLKNITSTSFMYSTSN
TRNIYPVMYSDTYELRARDHCLTARVLFLNEYKMHLSIAVQSGTNGPRNTVGTISGRLDS
DWVNEAWKVPSDFMDGPFRLVFTATIQGGSTGIIAIDDVNFSPQSGDCGQDDGGGTSARS
SGYSENPGLIAGIIIVLLLLIAVTIVAVMIRLKRSFTGKFPIVSFSNKQPDEQPVISDSG
GDNESGITGTSFTSATNVDTSQA
Download sequence
Identical sequences W4ZI48
SPU_027862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]