SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_028775 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_028775
Domain Number 1 Region: 165-285
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 2.22e-24
Family Dystroglycan, domain 2 0.0002
Further Details:      
 
Domain Number 2 Region: 49-143
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000377
Family Dystroglycan, N-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 474-575
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPU_028775
Sequence length 869
Sequence
MLVSLGQAQEINGVYRDWYEPQSRDNLGDESDALEPSFGVWKPVSPGWGIPDTTATVGVA
FSHKIPKEAFRGDVDKYMLKEVGAQSLPSWLNFSNKTNTLQGIPGKEDQRQYYISVTALG
KVSNLTKDSSNTKDVFSINVLPQDTPHTKSTDESTSKHKDGVVVCPPEKPAVRATIILDA
DWSLLTPQERINMVSKLSKYSRIPMTAFKLLPEKDDNKGYQALAAGSGNIATAKHEGLSL
SWVVGCGRNIDQLPVVTILEGASKDGSMAEKLNYDIKGWYVSSNTPIIKNRVRRQAPLMG
TVVPTALPTGAPKPTEVLSTVYPSTHIIPTESSPVLSSMIRTAGTQDPMTMTAKETSTKT
GKVSISPTVKASKTSFYKTSVITPTPTPVATTEVPTEAPTRAFSPPVPSMTATESLVVMP
TMTSTPVASIPVDTMAPTTVVIMPTPTKPVTTPSDTIPEPTTPKPATPYVNKGPEIVHPI
ERIDVIVGVPFVFVVPADTYMDPEDGNTRELSLMLVDADGTLLSSDFWLKFDKQKQTMFA
YTEKVFDVETYVMIAQDKEGVELRDAFEVHVLDSNAVQEDPPPVAMGATINIDFDEFINN
PELQLDILNRIASIFGDPDASALTITGIRRGSVILSFTNNTIPKDTCPVELIEELMKKLV
TPDGKPTQALIDAFSPNYTISGVEAAPQGTCDATTPAPTTPSTKAYIPPLDGNTKANDAW
ITNVLPGVIVAFIIILAGIVVFILYRRNRKGKLSDEDQNTFINKGIPIIFTEELDEADKH
PSSTPLIMKNEKPPLPPPEYSAEDGTRQPLMSDHRSQDDPNKPSMPMVDLGGSPPYEPPP
PITPSPPESRNPHAPSTTRFQSPPAYVPP
Download sequence
Identical sequences W4ZKQ4
SPU_028775 7668.XP_001188993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]