SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_030096 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_030096
Domain Number 1 Region: 5-63,187-557
Classification Level Classification E-value
Superfamily L domain-like 1.73e-36
Family Internalin LRR domain 0.055
Further Details:      
 
Domain Number 2 Region: 618-704
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-19
Family Toll/Interleukin receptor TIR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_030096
Sequence length 704
Sequence
FYPLKGLMYLSLDRNPRIVLPATGLFMMSSQLSFLDLTSTNLKSLPNDILKWSPHLGAAL
LSSNQLSTINVSSCGMTDYVDMTDNRLQHLTARYFTFVCHTDTLDLTENPIQSVDPDVIA
SLHVRSLILGKYAHTFSYEVLANIILGISKSDIERLRIEHGSVGAFPNGLFDPLRNSSLS
VLSFIMCDLNSLQPLVFSNLTKLKQFSLSSNNLPINEIQPDFFEGMNSLKVLTINNNRVR
KINPHDQTWTVDLSKLDLSGNLFAEISTSAFRGLGNLTFLDMSSNEYLSVFQLTAFLGLD
NIQTIDLSGSCIFVLELNTPILRSLSLNSLRSDSLPLQPGNSFQYLQSLVSLHMEDSKLL
LFDIWNEDRNASLFDGLLNLNHLDLSSNPGLSHRGDLPPGIFRQLSVLQELYLDYCEIRN
LHSLVFSGLESLKKLSLEGNYIKHTHGDVLSGLGQIKSINFEGNLISYLEEQMFSNNWNL
TNLSLANNRLTRLNESTFKPIFSSISLLDLSMNPIVCNCNLKWLIDWVHKSLRLKYEYNT
FCSSASLEPLREKPLLDFDPNELCIMNNGLFFLIPLASISLVVMSVMLYYYRWQLRYKLF
LLKLAVLCWKEMRDARDHNDYEFDVNIIFYDDDEEWIREQLRPALEERLPQFQRNVFGDD
DLVLGMHYLDSVDYVVSHSYKTIILLSRAAVHDHWFILKFRTAM
Download sequence
Identical sequences W4ZLB5
SPU_030096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]