SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_030113 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_030113
Domain Number 1 Region: 80-459
Classification Level Classification E-value
Superfamily L domain-like 1.02e-47
Family Ngr ectodomain-like 0.0054
Further Details:      
 
Domain Number 2 Region: 524-558
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000916
Family Toll/Interleukin receptor TIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_030113
Sequence length 565
Sequence
TFEISCQCETLVLFEIHIILVDPDVIASLHVRSLWVGHIPLSFEVLRNIFIGISRSTIEQ
FKLVDCVSEFPADFFDPLQGHYLSVLDFSMNNVRALYPFVFSNLTRTRLLDISDNYIETI
EPEFFENMQDIRVLKLQFNSITNLNTYNCSWKIGLTELDLSGNHLTKVSRYFFLGLQNLT
VVDMHSNKYLTYLDRDSFMGLNQIRTIDLSECNILCFYLVAPSLKSLFLYNKLNIPPIYL
EAGESFKNLQSLVHLNLRKTKLILEKLWTQNISLFDGLVSLTTLDLSRNSLGPRYGRAEY
LPPLVFKPLSALQILSLEHCQITFLHPLAFEALKFLRVLILRGNKIKQLPIDIFNIFGQI
TNIDLHNNRLTYLDKNLFFNNSRLTTLLLSENKLTRLNQSTFKLIGPSLTSVDLSRNPLD
CTCELSWLLTWISGPLVLKNKKKTICSSASLEPLREKPLFKFDSKTLCSPYNNIALYSLT
SLAIISFVVIVILVFHYRWQLRYKLFLLKLAAVGYNEMRDARDHNDYEFDMNVIFHEDDE
EWAREHLLPTLEERLPQFERNVFGD
Download sequence
Identical sequences SPU_030113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]