SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13541138|ref|NP_110826.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541138|ref|NP_110826.1|
Domain Number 1 Region: 6-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-46
Family Ribonuclease PH domain 1-like 0.00000369
Further Details:      
 
Domain Number 2 Region: 156-239
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-24
Family Ribonuclease PH domain 2-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13541138|ref|NP_110826.1|
Sequence length 248
Comment exosome complex exonuclease Rrp41 [Thermoplasma volcanium GSS1]
Sequence
MIKTETSKIKLINEDNLRLDGRSFNELRPIKIEAGVLNRADGSAYIEWGGNKIIVGVYGP
KEAYPKHSQDIDHAVVKARYNMAAFSVDERKRPGPDRRTMEISKVISEALSSSIMIEQFP
RAEIDVYIEVLQADAGTRIAGLTAATVALADAGIPMRDMVVGCTAGKVDGHIVLDLSKEE
DNFGEADIPMAIMPKTGEIVLLQMDGDVTEDEFYEATSMIIEATKKISQIQRNALLNKYK
IEGIEGGE
Download sequence
Identical sequences Q97BZ5
gi|13541138|ref|NP_110826.1| WP_010916565.1.10044 273116.TVN0307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]