SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13541139|ref|NP_110827.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541139|ref|NP_110827.1|
Domain Number 1 Region: 8-208
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-51
Family Ribonuclease PH domain 1-like 0.00000272
Further Details:      
 
Domain Number 2 Region: 180-257
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.75e-20
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|13541139|ref|NP_110827.1|
Sequence length 260
Comment exosome complex RNA-binding protein Rrp42 [Thermoplasma volcanium GSS1]
Sequence
MVKESAEILSEIRKNYILTTMKGGKRIDGRLPDEFREITIIENYVPRANGSAYVALGKTR
VVAGVKIEAGEPFPDTPDQGVLTTNVELLPIAFPSFEAGPPNDLAIEVSRVVDRGIRESK
MISPDKLVIEQGKKVWIVFLDINVLDYDGNLIDACTIAAVSALRNAIVPASREGGEDFKL
PVVNTPISVTMVKIGDTLVCDPSLEEDQICGGRITVTTTEDGHIRAMQKGEIGVFTLDDV
KKAIKMSLKVGKNIREKYFR
Download sequence
Identical sequences Q97BZ4
gi|13541139|ref|NP_110827.1| 273116.TVN0308 WP_010916566.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]