SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13541613|ref|NP_111301.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541613|ref|NP_111301.1|
Domain Number 1 Region: 35-196
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.63e-16
Family GHMP Kinase, N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 219-320
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000000000187
Family Mevalonate 5-diphosphate decarboxylase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13541613|ref|NP_111301.1|
Sequence length 359
Comment mevalonate pyrophosphate decarboxylase [Thermoplasma volcanium GSS1]
Sequence
MDLPGIVSLLKEKGLYRAPGKYRKEMRYGEIHYGSGYPITGLIKFLGYYDESLKIANFPS
ISLNTDVSEAYSAFMISKDNGNDTAVVEGENSPNITKKAMTAINVFKNLYDIKGSFHFYL
RIKRKYAGAKGLGESAAVAAAASRSLVSALFEKEALKDSNFISIVARLASGSGSKSVAGP
LSLWLTAPAVSHEGSFSLNLRKEIDDIFLCAVPIRDSVSTAEAHNTVIKSPFYQQWSRLQ
FDAVYSIISRGGYSAQIIENATTNTYLMHSVLISTGKLLWNQDTLRAMGIVEDMRRIGRL
IGFSIDTGPSVLVMADREDLIKEFKERYNGECIDASVPNGAPDIPSSFVESAERYFAKH
Download sequence
Identical sequences gi|13541613|ref|NP_111301.1| 273116.TVN0782 WP_010917040.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]