SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13541837|ref|NP_111525.1| from Thermoplasma volcanium GSS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13541837|ref|NP_111525.1|
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-31
Family GHMP Kinase, N-terminal domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 162-275
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.17e-24
Family Homoserine kinase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13541837|ref|NP_111525.1|
Sequence length 306
Comment homoserine kinase [Thermoplasma volcanium GSS1]
Sequence
MELSVISPCSSANLGPGYDVLAIAFDAFYDQVNVMLSDKLRILADEIPVQPDKNTAGLTA
LKMIEDFGIKDGIKISIKKGIPYGLGLGSSGSSAAAAAYAINNLFALGLERKDLIKYAAV
GELASSGSPHPDNVSASILGGLVIVSPEGISAKRIEVSDQFKFLLVIADLKIRDKTKYAR
SLVPSGVSMGDHKRNTSRVASLIAGLMSGDRELVSTGMNDDIVEAAREPIFPYYRRVKDT
AIESGAVGAVVSGAGPSILVVYDNKTETKQMIRKISRIYEGMGISVNFATPNVADGVREV
ANPLAD
Download sequence
Identical sequences WP_010917264.1.10044 gi|13541837|ref|NP_111525.1| 273116.TVN1006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]