SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28493589|ref|NP_787750.1| from Tropheryma whipplei str. Twist

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28493589|ref|NP_787750.1|
Domain Number 1 Region: 16-200
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-40
Family Ribonuclease PH domain 1-like 0.00000717
Further Details:      
 
Domain Number 2 Region: 170-253
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.41e-23
Family Ribonuclease PH domain 2-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28493589|ref|NP_787750.1|
Sequence length 256
Comment ribonuclease PH [Tropheryma whipplei str. Twist]
Sequence
MSVTSLAVYMLFCCIICSVLRKNSRAHDEIRPVKIIRGWNIYAEGSALIAFGNTRVLCNA
TFQRGVPPFLRGQRSGWITAEYAMLPRSGTERSDRESVKGKISGRSHEISRLIGRSMRAI
LDRYALEENTIILDCDVLQADGGTRTAAITGSYIALYDALVWAKNQKILSKHPLTDSVSA
VSVGLVGDQIFLDLDYSEDSNAQADINLVFTGSGKLVEIQGTAEKSPFSYGQFEQMMELA
KTGCQALKEIQAASLD
Download sequence
Identical sequences gi|28493589|ref|NP_787750.1| gi|28572785|ref|NP_789565.1| 203267.TWT622 218496.TW640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]