SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 100016.m00003 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  100016.m00003
Domain Number - Region: 125-154
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0481
Family Tudor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 100016.m00003
Sequence length 183
Sequence
MKHFLEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVL
DDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAK
RGVVIEILGYNINDDTYKVRYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIR
KFF
Download sequence
Identical sequences 100016.m00003 116067.m00004 118907.m00005 126312.m00003 83211.m00099 85021.m00004 85116.m00004 85270.m00004 87912.m00146 91289.m00005 92644.m00003 93986.m00224 94825.m00033 95435.m00003 98877.m00003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]