SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103076.m00004 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  103076.m00004
Domain Number - Region: 46-75
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0126
Family Tudor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 103076.m00004
Sequence length 104
Sequence
TLRKVNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAKRGVVIEILGYNINDDTYKV
IYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIRKFF
Download sequence
Identical sequences 103076.m00004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]