SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 119179.m00004 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  119179.m00004
Domain Number - Region: 125-154
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0632
Family Tudor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 119179.m00004
Sequence length 183
Sequence
MKHFLEVYNSSHHSKTGHTPNSMTHTQEEKYIQKNESQTQNIRNSTQFTLIPGTKVRVVL
DDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAK
RGVVIEILGYNTNDDTYKVRYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNKPERIR
KFF
Download sequence
Identical sequences 119179.m00004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]