SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 132790.m00010 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  132790.m00010
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.74e-54
Family Ankyrin repeat 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 132790.m00010
Sequence length 189
Sequence
MFCLFVSIWHKFNDKDNYGLAALHNAAKYNNKETAALLLSNHAKINEKDKKEKTTLHYAA
EFNNQETVELLLSNHAKINEKDKKEKTTLHYAAEFNNQETVELLLSNHAKINEKDKKEKT
TLHYVAEYNNKETTEILLSYGAKVNEYDNSEVTSLNNAAKYNNKETVELLLSHGAKVNWA
VNFAQKEMV
Download sequence
Identical sequences A2GED9
XP_001297405.1.43485 132790.m00010 gi|121877548|gb|EAX84475.1| gi|123371548|ref|XP_001297405.1| 5722.A2GED9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]