SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 136357.m00004 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  136357.m00004
Domain Number - Region: 125-154
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0632
Family Tudor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 136357.m00004
Sequence length 183
Sequence
MKHFLEVYNSSTHSTTGHTPNSMTQQQEEKYIQKKRSQTQNIRNSTQFTLIPGTKVRVVL
DDKPLTKKRLRLSRNYYIVDSTQGNGYLIKAADDSIAFYPRHKLVESSNGKLAETIDEAK
RGVVIEILGYNTNDDTYKVRYEGGVEDVIPSKNLRESKPTHLGPLEREYWKDKNMPERIR
KFF
Download sequence
Identical sequences 101593.m00003 111107.m00003 117833.m00004 132402.m00004 136357.m00004 80272.m00003 82997.m00007 86087.m00004 87772.m00005 88110.m00020 95953.m00003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]