SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 80222.m00152 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  80222.m00152
Domain Number 1 Region: 194-328
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.09e-19
Family Staphylococcal nuclease 0.0024
Further Details:      
 
Domain Number 2 Region: 110-191
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000115
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 3 Region: 526-604
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000012
Family Tudor domain 0.015
Further Details:      
 
Domain Number 4 Region: 352-483
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000235
Family Staphylococcal nuclease 0.023
Further Details:      
 
Domain Number 5 Region: 496-513,592-703
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000222
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 80222.m00152
Sequence length 708
Sequence
MNNQGFLGVNSDQAKSDATKSVNIGKDVDAGTLGNLNKIAKSNEIKDPHPLSDKELAENA
QLRITLLGISMESFLFICVNENGVKFPVELAGIAHTNITSSSPIIRNLFIDFFVENLLDK
QFLLRIHTKSPNGYVGTLTQGNRDIGATMLIKGIVRFNSLTSNYLSKPNHFQALETTAKR
QGTGIWADTNYKEIRTKPFPAQILAIPSSNTFTIINESGDEELFYLSTVHCPDFSFNGIS
EPFGFEAWNFIRETVIGKEVYITLDDDRADKKFATIKIGNEILNEMLCRKGLALLSINRV
RKNSDYIEQIRNAYLYAQENQIGIFGSEIPKPVLVKELNREDRDLLMADEYSRNVRAIIV
EVTGSVYLKLFVPSLQTILRVSLVGLVPLQSNDWTSRRAMEVLRRCFLHHEVDVTITRYA
EHSRYYRVLIYDSISKLDARVPPVHEGLVHYNKLATDDPSTNKDELEQHAEEARSKSIGI
FKSEGRNSSQIPKDKAIPVIITKVIDETTYAVQAQNDNSTKVNELLKADFPQLELLPMED
QYVIMVRNGVNYRAQVVRNRGPEVFVNLIDYGVDVWSFVSDLRKYDDELMQYQPNGFVVS
LAFIQPFRNRSKQFTETCLNYIANIFALGNSVYIRRPFDRELPCVMMMMNDTPAAMTLQY
ALVHDGICTVIDEDVHQLFLPVVKELRKVMANAKENKFGGWSLQESLI
Download sequence
Identical sequences A2EHS9
XP_001319992.1.43485 5722.A2EHS9 80222.m00152 gi|121902788|gb|EAY07769.1| gi|123473610|ref|XP_001319992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]