SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 80339.m00046 from Trichomonas vaginalis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  80339.m00046
Domain Number - Region: 100-129
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0156
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 80339.m00046
Sequence length 158
Sequence
MTSKEEDEYIKQKRMLTEERRSSSLLLGTKVRIILEHKPHEKVRNQLSDDYYIVDSSQGN
GYLIKAADHSVAFYPRFRLVESENGRLAKTVDEAKRGIVNKIVSYDEDKDEYTVIYEGGV
DDKIPSRNLRESNPTHLSELERDYWKDKNKPKLIKIFL
Download sequence
Identical sequences A2G4M4
5722.A2G4M4 gi|121881917|gb|EAX87889.1| gi|123395901|ref|XP_001300819.1| 80339.m00046 XP_001300819.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]